Peptide identification is performed using third-party software - there
is no package to run these searches directly in R. When using command
line search engines it possible to hard-code or automatically generate
the search command lines and run them from R using a system()
call. This allows to generate these reproducibly (especially useful if
many command lines need to be run) and to keep a record in the R
script of the exact command.
The example below illustrates this for 3 mzML files to be searched
using MSGFplus
:
## [1] "file_1.mzML" "file_2.mzML" "file_3.mzML"
## [1] "file_1.mzid" "file_2.mzid" "file_3.mzid"
paste0("java -jar /path/to/MSGFPlus.jar",
" -s ", mzmls,
" -o ", mzids,
" -d uniprot.fas",
" -t 20ppm",
" -m 0",
" int 1")
## [1] "java -jar /path/to/MSGFPlus.jar -s file_1.mzML -o file_1.mzid -d uniprot.fas -t 20ppm -m 0 int 1"
## [2] "java -jar /path/to/MSGFPlus.jar -s file_2.mzML -o file_2.mzid -d uniprot.fas -t 20ppm -m 0 int 1"
## [3] "java -jar /path/to/MSGFPlus.jar -s file_3.mzML -o file_3.mzid -d uniprot.fas -t 20ppm -m 0 int 1"
Let’s use the identification from msdata
:
## [1] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid"
The easiest way to read identification data in mzIdentML
(often
abbreviated with mzid
) into R is to read it with the readPSMs()
function from the
PSMatch
package5 Previously named PSM
.. The function will parse the file and return a
DataFrame
.
## [1] 5802 35
## [1] "sequence" "spectrumID"
## [3] "chargeState" "rank"
## [5] "passThreshold" "experimentalMassToCharge"
## [7] "calculatedMassToCharge" "peptideRef"
## [9] "modNum" "isDecoy"
## [11] "post" "pre"
## [13] "start" "end"
## [15] "DatabaseAccess" "DBseqLength"
## [17] "DatabaseSeq" "DatabaseDescription"
## [19] "scan.number.s." "acquisitionNum"
## [21] "spectrumFile" "idFile"
## [23] "MS.GF.RawScore" "MS.GF.DeNovoScore"
## [25] "MS.GF.SpecEValue" "MS.GF.EValue"
## [27] "MS.GF.QValue" "MS.GF.PepQValue"
## [29] "modPeptideRef" "modName"
## [31] "modMass" "modLocation"
## [33] "subOriginalResidue" "subReplacementResidue"
## [35] "subLocation"
► Question
Verify that this table contains 5802 matches for 5343 scans and 4938 peptides sequences.
► Solution
The PSM data are read as is, without any filtering. As we can see below, we still have all the hits from the forward and reverse (decoy) databases.
##
## FALSE TRUE
## 2906 2896
The data contains also contains multiple matches for several spectra. The table below shows the number of number of spectra that have 1, 2, … up to 5 matches.
##
## 1 2 3 4 5
## 4936 369 26 10 2
Below, we can see how scan 1774 has 4 matches, all to sequence
RTRYQAEVR
, which itself matches to 4 different proteins:
i <- which(id$spectrumID == "controllerType=0 controllerNumber=1 scan=1774")
data.frame(id[i, ])[1:5]
## sequence spectrumID chargeState rank
## 1 RTRYQAEVR controllerType=0 controllerNumber=1 scan=1774 2 1
## 2 RTRYQAEVR controllerType=0 controllerNumber=1 scan=1774 2 1
## 3 RTRYQAEVR controllerType=0 controllerNumber=1 scan=1774 2 1
## 4 RTRYQAEVR controllerType=0 controllerNumber=1 scan=1774 2 1
## passThreshold
## 1 TRUE
## 2 TRUE
## 3 TRUE
## 4 TRUE
If the goal is to keep all the matches, but arranged by scan/spectrum,
one can reduce the PSM
object by the spectrumID
variable, so
that each scan correponds to a single row that still stores all
values6 The rownames aren’t needed here are are removed to reduce
to output in the the next code chunk display parts of id2
.:
## Reduced PSM with 5343 rows and 35 columns.
## names(35): sequence spectrumID ... subReplacementResidue subLocation
The resulting object contains a single entry for scan 1774 with information for the multiple matches stored as lists within the cells.
## Reduced PSM with 1 rows and 35 columns.
## names(35): sequence spectrumID ... subReplacementResidue subLocation
## CharacterList of length 1
## [["controllerType=0 controllerNumber=1 scan=1774"]] ECA2104 ECA2867 ECA3427 ECA4142
The is the type of complete identification table that could be used to
annotate an raw mass spectrometry Spectra
object, as shown below.
Often, the PSM data is filtered to only retain reliable matches. The
MSnID
package can be used to set thresholds to attain user-defined
PSM, peptide or protein-level FDRs. Here, we will simply filter out
wrong identification manually.
Here, the filter()
from the dplyr
package comes very handy. We
will thus start by converting the DataFrame
to a tibble
.
## # A tibble: 5,802 × 35
## sequence spectrumID chargeState rank passThreshold experimentalMassToCh…¹
## <chr> <chr> <int> <int> <lgl> <dbl>
## 1 RQCRTDFLNY… controlle… 3 1 TRUE 548.
## 2 ESVALADQVT… controlle… 2 1 TRUE 1288.
## 3 KELLCLAMQI… controlle… 2 1 TRUE 744.
## 4 QRMARTSDKQ… controlle… 3 1 TRUE 913.
## 5 KDEGSTEPLK… controlle… 3 1 TRUE 927.
## 6 DGGPAIYGHE… controlle… 3 1 TRUE 969.
## 7 QRMARTSDKQ… controlle… 2 1 TRUE 1369.
## 8 CIDRARHVEV… controlle… 3 1 TRUE 1285.
## 9 CIDRARHVEV… controlle… 3 1 TRUE 1285.
## 10 VGRCRPIINY… controlle… 2 1 TRUE 1102.
## # ℹ 5,792 more rows
## # ℹ abbreviated name: ¹experimentalMassToCharge
## # ℹ 29 more variables: calculatedMassToCharge <dbl>, peptideRef <chr>,
## # modNum <int>, isDecoy <lgl>, post <chr>, pre <chr>, start <int>, end <int>,
## # DatabaseAccess <chr>, DBseqLength <int>, DatabaseSeq <chr>,
## # DatabaseDescription <chr>, scan.number.s. <dbl>, acquisitionNum <dbl>,
## # spectrumFile <chr>, idFile <chr>, MS.GF.RawScore <dbl>, …
► Question
► Solution
► Question
► Solution
► Question
XXX_ECA3406
and ECA3415
. Scan 4099 match XXX_ECA4416_1
,
XXX_ECA4416_2
and XXX_ECA4416_3
. Then remove the scans that
match any of these proteins.
► Solution
Which leaves us with 2666 PSMs.
This can also be achieved with the filterPSMs()
function, or the
individual filterPsmRank()
, filterPsmDecoy
and filterPsmShared()
functions:
## Starting with 5802 PSMs:
## Removed 2896 decoy hits.
## Removed 155 PSMs with rank > 1.
## Removed 85 shared peptides.
## 2666 PSMs left.
The describePeptides()
and describeProteins()
functions from the
PSMatch
package provide useful summaries of preptides and proteins
in a PSM search result.
describePeptides()
gives the number of unique and shared peptides
and for the latter, the size of their protein groups:## 2324 peptides composed of
## unique peptides: 2324
## shared peptides (among protein):
## ()
describeProteins()
gives the number of proteins defined by only
unique, only shared, or a mixture of unique/shared peptides:## 1466 proteins composed of
## only unique peptides: 1466
## only shared peptides: 0
## unique and shared peptides: 0
The Understanding protein groups with adjacency
matrices
PSMatch
vignette provides additional tools to explore how proteins
were inferred from peptides.
► Question
Compare the distribution of raw identification scores of the decoy and non-decoy hits. Interpret the figure.
► Solution
► Question
The tidyverse
tools are fit for data wrangling with identification data. Using the
above identification dataframe, calculate the length of each peptide
(you can use nchar
with the peptide sequence sequence
) and the
number of peptides for each protein (defined as
DatabaseDescription
). Plot the length of the proteins against their
respective number of peptides.
► Solution
If you would like to learn more about how the mzid data are handled by
PSMatch
via the mzR and mzID
packages, check out the 6.2 section in the annex.
We are goind to use the sp
object created in the previous chapter
and the id_filtered
variable generated above.
Identification data (as a DataFrame
) can be merged into raw data (as
a Spectra
object) by adding new spectra variables to the appropriate
MS2 spectra. Scans and peptide-spectrum matches can be matched by
their spectrum identifers.
► Question
Identify the spectum identifier columns in the sp
the id_filtered
variables.
► Solution
We still have several PTMs that are matched to a single spectrum identifier:
##
## 1 2 3 4
## 2630 13 2 1
Let’s look at "controllerType=0 controllerNumber=1 scan=5490"
, the
has 4 matching PSMs in detail.
## controllerType=0 controllerNumber=1 scan=5490
## 1903
id_4 <- id_filtered[id_filtered$spectrumID == "controllerType=0 controllerNumber=1 scan=5490", ] %>%
as.data.frame()
id_4
## sequence spectrumID chargeState
## 1 KCNQCLKVACTLFYCK controllerType=0 controllerNumber=1 scan=5490 3
## 2 KCNQCLKVACTLFYCK controllerType=0 controllerNumber=1 scan=5490 3
## rank passThreshold experimentalMassToCharge calculatedMassToCharge peptideRef
## 1 1 TRUE 698.6633 698.3315 Pep453
## 2 1 TRUE 698.6633 698.3315 Pep453
## modNum isDecoy post pre start end DatabaseAccess DBseqLength DatabaseSeq
## 1 4 FALSE C K 127 142 ECA0668 302
## 2 4 FALSE C K 127 142 ECA0668 302
## DatabaseDescription scan.number.s. acquisitionNum
## 1 ECA0668 hypothetical protein 5490 5490
## 2 ECA0668 hypothetical protein 5490 5490
## spectrumFile
## 1 TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML
## 2 TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML
## idFile
## 1 TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid
## 2 TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid
## MS.GF.RawScore MS.GF.DeNovoScore MS.GF.SpecEValue MS.GF.EValue MS.GF.QValue
## 1 -22 79 4.555588e-07 1.307689 0.9006211
## 2 -22 79 4.555588e-07 1.307689 0.9006211
## MS.GF.PepQValue modPeptideRef modName modMass modLocation
## 1 0.8901099 Pep453 Carbamidomethyl 57.02146 2
## 2 0.8901099 Pep453 Carbamidomethyl 57.02146 5
## subOriginalResidue subReplacementResidue subLocation
## 1 <NA> <NA> NA
## 2 <NA> <NA> NA
## [ reached 'max' / getOption("max.print") -- omitted 2 rows ]
We can see that these 4 PSMs differ by the location of the Carbamidomethyl modification.
## modName modLocation
## 1 Carbamidomethyl 2
## 2 Carbamidomethyl 5
## 3 Carbamidomethyl 10
## 4 Carbamidomethyl 15
Let’s reduce that PSM table before joining it to the Spectra
object,
to make sure we have unique one-to-one matches between the raw spectra
and the PSMs.
## Reduced PSM with 2646 rows and 35 columns.
## names(35): sequence spectrumID ... subReplacementResidue subLocation
These two data can thus simply be joined using:
sp <- joinSpectraData(sp, id_filtered,
by.x = "spectrumId",
by.y = "spectrumID")
spectraVariables(sp)
## [1] "msLevel" "rtime"
## [3] "acquisitionNum" "scanIndex"
## [5] "dataStorage" "dataOrigin"
## [7] "centroided" "smoothed"
## [9] "polarity" "precScanNum"
## [11] "precursorMz" "precursorIntensity"
## [13] "precursorCharge" "collisionEnergy"
## [15] "isolationWindowLowerMz" "isolationWindowTargetMz"
## [17] "isolationWindowUpperMz" "peaksCount"
## [19] "totIonCurrent" "basePeakMZ"
## [21] "basePeakIntensity" "ionisationEnergy"
## [23] "lowMZ" "highMZ"
## [25] "mergedScan" "mergedResultScanNum"
## [27] "mergedResultStartScanNum" "mergedResultEndScanNum"
## [29] "injectionTime" "filterString"
## [31] "spectrumId" "ionMobilityDriftTime"
## [33] "scanWindowLowerLimit" "scanWindowUpperLimit"
## [35] "rtime_minute" "sequence"
## [37] "chargeState" "rank"
## [39] "passThreshold" "experimentalMassToCharge"
## [41] "calculatedMassToCharge" "peptideRef"
## [43] "modNum" "isDecoy"
## [45] "post" "pre"
## [47] "start" "end"
## [49] "DatabaseAccess" "DBseqLength"
## [51] "DatabaseSeq" "DatabaseDescription"
## [53] "scan.number.s." "acquisitionNum.y"
## [55] "spectrumFile" "idFile"
## [57] "MS.GF.RawScore" "MS.GF.DeNovoScore"
## [59] "MS.GF.SpecEValue" "MS.GF.EValue"
## [61] "MS.GF.QValue" "MS.GF.PepQValue"
## [63] "modPeptideRef" "modName"
## [65] "modMass" "modLocation"
## [67] "subOriginalResidue" "subReplacementResidue"
## [69] "subLocation"
► Question
Verify that the identification data has been added to the correct spectra.
► Solution
Now that we have combined raw data and their associated peptide-spectrum matches, we can produce an improved total ion chromatogram, identifying MS1 scans that lead to successful identifications.
The countIdentifications()
function is going to tally the number of
identifications (i.e non-missing characters in the sequence
spectra
variable) for each scan. In the case of MS2 scans, these will be
either 1 or 0, depending on the presence of a sequence. For MS1 scans,
the function will count the number of sequences for the descendant MS2
scans, i.e. those produced from precursor ions from each MS1 scan.
Below, we see on the second line that 3457 MS2 scans lead to no PSM, while 2546 lead to an identification. Among all MS1 scans, 833 lead to no MS2 scans with PSMs. 30 MS1 scans generated one MS2 scan that lead to a PSM, 45 lead to two PSMs, …
##
## 0 1 2 3 4 5 6 7 8 9 10
## 1 833 30 45 97 139 132 92 42 17 3 1
## 2 3457 2646 0 0 0 0 0 0 0 0 0
These data can also be visualised on the total ion chromatogram:
sp |>
filterMsLevel(1) |>
spectraData() |>
as_tibble() |>
ggplot(aes(x = rtime,
y = totIonCurrent)) +
geom_line(alpha = 0.25) +
geom_point(aes(colour = ifelse(countIdentifications == 0,
NA, countIdentifications)),
size = 0.75,
alpha = 0.5) +
labs(colour = "Number of ids")
Let’s choose a MS2 spectrum with a high identification score and plot it.
We have seen above that we can add labels to each peak using the
labels
argument in plotSpectra()
. The addFragments()
function
takes a spectrum as input (that is a Spectra
object of length 1) and
annotates its peaks.
## [1] NA NA NA "b1" NA NA NA NA NA NA NA NA
## [13] NA NA NA NA NA NA NA NA NA NA NA NA
## [25] NA NA NA NA NA NA NA NA NA NA NA NA
## [37] NA NA NA NA NA NA NA "y1_" NA NA NA NA
## [49] NA "y1" NA NA NA NA NA NA NA NA NA NA
## [61] NA NA NA NA NA NA NA NA NA NA NA NA
## [73] NA NA NA NA NA NA NA NA NA NA NA NA
## [85] NA NA "b2" NA NA NA NA NA NA NA NA NA
## [97] NA NA NA NA
## [ reached getOption("max.print") -- omitted 227 entries ]
It can be directly used with plotSpectra()
:
When a precursor peptide ion is fragmented in a CID cell, it breaks at specific bonds, producing sets of peaks (a, b, c and x, y, z) that can be predicted.
(#fig:frag_img)Peptide fragmentation.
The annotation of spectra is obtained by simulating fragmentation of a peptide and matching observed peaks to fragments:
## [1] "THSQEEMQHMQR"
## Modifications used: C=57.02146
## mz ion type pos z seq
## 1 102.0550 b1 b 1 1 T
## 2 239.1139 b2 b 2 1 TH
## 3 326.1459 b3 b 3 1 THS
## 4 454.2045 b4 b 4 1 THSQ
## 5 583.2471 b5 b 5 1 THSQE
## 6 712.2897 b6 b 6 1 THSQEE
## 7 843.3301 b7 b 7 1 THSQEEM
## 8 971.3887 b8 b 8 1 THSQEEMQ
## 9 1108.4476 b9 b 9 1 THSQEEMQH
## 10 1239.4881 b10 b 10 1 THSQEEMQHM
## 11 1367.5467 b11 b 11 1 THSQEEMQHMQ
## 12 175.1190 y1 y 1 1 R
## 13 303.1775 y2 y 2 1 QR
## 14 434.2180 y3 y 3 1 MQR
## 15 571.2769 y4 y 4 1 HMQR
## 16 699.3355 y5 y 5 1 QHMQR
## [ reached 'max' / getOption("max.print") -- omitted 42 rows ]
The compareSpectra()
function can be used to compare spectra (by default,
computing the normalised dot product).
► Question
Spectra
object containing the MS2 spectra with
sequences "SQILQQAGTSVLSQANQVPQTVLSLLR"
and
"TKGLNVMQNLLTAHPDVQAVFAQNDEMALGALR"
.
► Solution
► Question
compareSpectra
. See the
?Spectra
man page for details. Draw a heatmap of that matrix.
► Solution
► Question
► Solution
► Question
Download the 3 first mzML and mzID files from the PXD022816 project (Morgenstern, Barzilay, and Levin 2021Morgenstern, David, Rotem Barzilay, and Yishai Levin. 2021. “RawBeans: A Simple, Vendor-Independent, Raw-Data Quality-Control Tool.” Journal of Proteome Research. https://doi.org/10.1021/acs.jproteome.0c00956.).
► Solution
► Question
Generate a Spectra
object and a table of filtered PSMs. Visualise
the total ion chromatograms and check the quality of the
identification data by comparing the density of the decoy and target
PSMs id scores for each file.
► Solution
► Question
Join the raw and identification data. Beware though that the joining must now be performed by spectrum ids and by files.
► Solution
► Question
Extract the PSMs that have been matched to peptides from protein
O43175
and compare and cluster the scans. Hint: once you have
created the smaller Spectra
object with the scans of interest,
switch to an in-memory backend to seed up the calculations.
► Solution
► Question
Generate total ion chromatograms for each acquisition and annotate the
MS1 scans with the number of PSMs using the countIdentifications()
function, as shown above. The function will automatically perform the
counts in parallel for each acquisition.
► Solution
MSnID
The MSnID
package extracts MS/MS ID data from mzIdentML (leveraging
the mzID
package) or text files. After collating the search results
from multiple datasets it assesses their identification quality and
optimises filtering criteria to achieve the maximum number of
identifications while not exceeding a specified false discovery
rate. It also contains a number of utilities to explore the MS/MS
results and assess missed and irregular enzymatic cleavages, mass
measurement accuracy, etc.
Let’s reproduce parts of the analysis described the MSnID
vignette. You can explore more with
The MSnID package can be used for post-search filtering
of MS/MS identifications. One starts with the construction of an
MSnID
object that is populated with identification results that can
be imported from a data.frame
or from mzIdenML
files. Here, we
will use the example identification data provided with the package.
## [1] "c_elegans.mzid.gz"
We start by loading the package, initialising the MSnID
object, and
add the identification result from our mzid
file (there could of
course be more than one).
## Note, the anticipated/suggested columns in the
## peptide-to-spectrum matching results are:
## -----------------------------------------------
## accession
## calculatedMassToCharge
## chargeState
## experimentalMassToCharge
## isDecoy
## peptide
## spectrumFile
## spectrumID
## Loaded cached data
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 12263 at 36 % FDR
## #peptides: 9489 at 44 % FDR
## #accessions: 7414 at 76 % FDR
Printing the MSnID
object returns some basic information such as
The package then enables to define, optimise and apply filtering based for example on missed cleavages, identification scores, precursor mass errors, etc. and assess PSM, peptide and protein FDR levels. To properly function, it expects to have access to the following data
## [1] "accession" "calculatedMassToCharge"
## [3] "chargeState" "experimentalMassToCharge"
## [5] "isDecoy" "peptide"
## [7] "spectrumFile" "spectrumID"
which are indeed present in our data:
## [1] "spectrumID" "scan number(s)"
## [3] "acquisitionNum" "passThreshold"
## [5] "rank" "calculatedMassToCharge"
## [7] "experimentalMassToCharge" "chargeState"
## [9] "MS-GF:DeNovoScore" "MS-GF:EValue"
## [11] "MS-GF:PepQValue" "MS-GF:QValue"
## [13] "MS-GF:RawScore" "MS-GF:SpecEValue"
## [15] "AssumedDissociationMethod" "IsotopeError"
## [17] "isDecoy" "post"
## [19] "pre" "end"
## [21] "start" "accession"
## [23] "length" "description"
## [25] "pepSeq" "modified"
## [27] "modification" "idFile"
## [29] "spectrumFile" "databaseFile"
## [31] "peptide"
Here, we summarise a few steps and redirect the reader to the package’s vignette for more details:
Cleaning irregular cleavages at the termini of the peptides and
missing cleavage site within the peptide sequences. The following two
function calls create the new numMisCleavages
and numIrregCleavages
columns in the MSnID
object
Now, we can use the apply_filter
function to effectively apply
filters. The strings passed to the function represent expressions that
will be evaluated, thus keeping only PSMs that have 0 irregular
cleavages and 2 or less missed cleavages.
msnid <- apply_filter(msnid, "numIrregCleavages == 0")
msnid <- apply_filter(msnid, "numMissCleavages <= 2")
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 7838 at 17 % FDR
## #peptides: 5598 at 23 % FDR
## #accessions: 3759 at 53 % FDR
Using "calculatedMassToCharge"
and "experimentalMassToCharge"
, the
mass_measurement_error
function calculates the parent ion mass
measurement error in parts per million.
## Min. 1st Qu. Median Mean 3rd Qu. Max.
## -2184.0640 -0.6992 0.0000 17.6146 0.7512 2012.5178
We then filter any matches that do not fit the +/- 20 ppm tolerance
msnid <- apply_filter(msnid, "abs(mass_measurement_error(msnid)) < 20")
summary(mass_measurement_error(msnid))
## Min. 1st Qu. Median Mean 3rd Qu. Max.
## -19.7797 -0.5866 0.0000 -0.2970 0.5713 19.6758
Filtering of the identification data will rely on
MS2 filters are handled by a special MSnIDFilter
class objects, where
individual filters are set by name (that is present in names(msnid)
)
and comparison operator (>, <, = , …) defining if we should retain
hits with higher or lower given the threshold and finally the
threshold value itself.
filtObj <- MSnIDFilter(msnid)
filtObj$absParentMassErrorPPM <- list(comparison="<", threshold=10.0)
filtObj$msmsScore <- list(comparison=">", threshold=10.0)
show(filtObj)
## MSnIDFilter object
## (absParentMassErrorPPM < 10) & (msmsScore > 10)
We can then evaluate the filter on the identification data object, which returns the false discovery rate and number of retained identifications for the filtering criteria at hand.
## fdr n
## PSM 0 3807
## peptide 0 2455
## accession 0 1009
Rather than setting filtering values by hand, as shown above, these can be set automatically to meet a specific false discovery rate.
filtObj.grid <- optimize_filter(filtObj, msnid, fdr.max=0.01,
method="Grid", level="peptide",
n.iter=500)
show(filtObj.grid)
## MSnIDFilter object
## (absParentMassErrorPPM < 3) & (msmsScore > 7.4)
## fdr n
## PSM 0.004097561 5146
## peptide 0.006447651 3278
## accession 0.021996616 1208
Filters can eventually be applied (rather than just evaluated) using
the apply_filter
function.
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 5146 at 0.41 % FDR
## #peptides: 3278 at 0.64 % FDR
## #accessions: 1208 at 2.2 % FDR
And finally, identifications that matched decoy and contaminant protein sequences are removed
msnid <- apply_filter(msnid, "isDecoy == FALSE")
msnid <- apply_filter(msnid, "!grepl('Contaminant',accession)")
show(msnid)
## MSnID object
## Working directory: "."
## #Spectrum Files: 1
## #PSMs: 5117 at 0 % FDR
## #peptides: 3251 at 0 % FDR
## #accessions: 1179 at 0 % FDR
MSnID
data
The resulting filtered identification data can be exported to a
data.frame
(or to a dedicated MSnSet
data structure from the
MSnbase
package) for quantitative MS data, described below, and
further processed and analysed using appropriate statistical tests.
## spectrumID scan number(s) acquisitionNum passThreshold rank
## 1 index=7151 8819 7151 TRUE 1
## 2 index=8520 10419 8520 TRUE 1
## calculatedMassToCharge experimentalMassToCharge chargeState MS-GF:DeNovoScore
## 1 1270.318 1270.318 3 287
## 2 1426.737 1426.739 3 270
## MS-GF:EValue MS-GF:PepQValue MS-GF:QValue MS-GF:RawScore MS-GF:SpecEValue
## 1 1.709082e-24 0 0 239 1.007452e-31
## 2 3.780745e-24 0 0 230 2.217275e-31
## AssumedDissociationMethod IsotopeError isDecoy post pre end start accession
## 1 CID 0 FALSE A K 283 249 CE02347
## 2 CID 0 FALSE A K 182 142 CE07055
## length
## 1 393
## 2 206
## description
## 1 WBGene00001993; locus:hpd-1; 4-hydroxyphenylpyruvate dioxygenase; status:Confirmed; UniProt:Q22633; protein_id:CAA90315.1; T21C12.2
## 2 WBGene00001755; locus:gst-7; glutathione S-transferase; status:Confirmed; UniProt:P91253; protein_id:AAB37846.1; F11G11.2
## pepSeq modified modification
## 1 AISQIQEYVDYYGGSGVQHIALNTSDIITAIEALR FALSE <NA>
## 2 SAGSGYLVGDSLTFVDLLVAQHTADLLAANAALLDEFPQFK FALSE <NA>
## idFile spectrumFile
## 1 c_elegans.mzid.gz c_elegans_A_3_1_21Apr10_Draco_10-03-04_dta.txt
## 2 c_elegans.mzid.gz c_elegans_A_3_1_21Apr10_Draco_10-03-04_dta.txt
## databaseFile peptide
## 1 ID_004174_E48C5B52.fasta K.AISQIQEYVDYYGGSGVQHIALNTSDIITAIEALR.A
## 2 ID_004174_E48C5B52.fasta K.SAGSGYLVGDSLTFVDLLVAQHTADLLAANAALLDEFPQFK.A
## numIrregCleavages numMissCleavages msmsScore absParentMassErrorPPM
## 1 0 0 30.99678 0.3843772
## 2 0 0 30.65418 1.3689451
## [ reached 'max' / getOption("max.print") -- omitted 4 rows ]
Page built: 2025-03-05 using R version 4.4.1 (2024-06-14)